PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G309500.1
Common NamePHAVU_002G309500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 183aa    MW: 20718.8 Da    PI: 10.0364
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G309500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.71.2e-211158350
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        ++n   + vtfskRr+g++KKA+ELSvLC+aeva+++fs+ +k y y+
  Phvul.002G309500.1 11 VKNPNTKLVTFSKRRTGLFKKANELSVLCGAEVAIVMFSPGQKPYSYA 58
                        56777889***********************************99997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.7E-26174IPR002100Transcription factor, MADS-box
SMARTSM004324.8E-30160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.329161IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-19323IPR002100Transcription factor, MADS-box
PfamPF003193.8E-231257IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MGRRRIEIAE VKNPNTKLVT FSKRRTGLFK KANELSVLCG AEVAIVMFSP GQKPYSYAHP  60
SVDVVADKYL RRKRRSNVVG ANVRENNASN EVGERLCQEL SAVEVLTEEE HKKATELEMR  120
EKEQEASQFS QNKELLQSSP ALQRMVKDYV DAMEVSECML LLAKEAVIGV PNRPITKRRR  180
RN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-15169169Myocyte-specific enhancer factor 2B
1tqe_Q3e-15169169Myocyte-specific enhancer factor 2B
1tqe_R3e-15169169Myocyte-specific enhancer factor 2B
1tqe_S3e-15169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16673DKYLRRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007160294.11e-131hypothetical protein PHAVU_002G309500g
TrEMBLV7CSF81e-131V7CSF8_PHAVU; Uncharacterized protein
STRINGGLYMA05G35811.15e-68(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24242979
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G66656.11e-29AGAMOUS-like 91